Scaffold Ga0101728_102216

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101728_102216

Scaffold Ga0101728_102216

Overview

Basic Information
Taxon OID	3300006654 Open in IMG/M
Scaffold ID	Ga0101728_102216 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0125100, Gp0113270, Gp0125099
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10407
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336)

Source Dataset Sampling Location
Location Name	North Pond, Atlantic Ocean
Coordinates	Lat. (^o)	22.78	Long. (^o)	-46.09	Alt. (m)		Depth (m)	4350
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045995	Metagenome	152	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101728_10221615	F045995	GAGG	MWTNNIVTFYGADEDLKKVAERLYSPGETSEEDNCFDFNKIIPFPNELSYIHSSRFNSGEKMIHGREYEQWYYVNSDGKMIENNPDNYFEKSRLKGMSSRMEKQFMRKYGALNGTDWRAINWGTIWNSNSGPGEKSREKLVYNFRTNYGSARLIVLEIESMIYRGEFPKVKMMWEHDNVDVHLCFMEDDEYVPDPTPVFTVGFAETEKSTAEYYKW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.