Basic Information | |
---|---|
Taxon OID | 3300006674 Open in IMG/M |
Scaffold ID | Ga0101770_1068514 Open in IMG/M |
Source Dataset Name | Anaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Norwegian Sequencing Centre (NSC) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1664 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fredrikstad, Norway | |||||||
Coordinates | Lat. (o) | 59.185359 | Long. (o) | 10.970104 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077200 | Metagenome / Metatranscriptome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101770_10685141 | F077200 | AGAAG | MKFTVIEVKTQPNLKRIEEYARRYGMTPEEALEKKRIGDDYFPIREQQIVSVGLLNLFSDKEDSVSVMAAVYAGEEKKVLEETAKKLEKIVKATGKPFFITGDGRKYALEILGGRALAYMIEAKKADQEIIPELKDMIRLITSQKNGYLKPFDFRDSVDLQAMLGLGSDRTPLPDGLKYDNKSLPALAEETKSTVLDMAVNYAAYLEAQGEKIKPVVYKLNEKIFKTVEIFEFPEKKEQEQELETNDIDIN* |
⦗Top⦘ |