NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098038_1054437

Scaffold Ga0098038_1054437


Overview

Basic Information
Taxon OID3300006735 Open in IMG/M
Scaffold IDGa0098038_1054437 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1439
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-12.999Long. (o)-80.801Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017554Metagenome / Metatranscriptome240Y
F049032Metagenome / Metatranscriptome147Y
F084338Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0098038_10544371F084338N/AKEGTIVLDYYPLKSWQSKIFPEKYLRVLSFKGDIQNKRLVTQEKLDEEVRDRVDNYNYSITGNNDNLPQFFTSEVLL*LQLFHQP*QIMKG*
Ga0098038_10544374F017554GAGGMNTTILYSFPNDLKYRYMSFNTYQQALDCIELFKQIEVKAEVKV*
Ga0098038_10544376F049032GGAGGMNNYSQNRGSEVINKLTDYSYNVNMYEEIKHYYLTEKYTVFPQVYNNSCGKSIN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.