Scaffold Ga0098042_1059629

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098042_1059629

Scaffold Ga0098042_1059629

Overview

Basic Information
Taxon OID	3300006749 Open in IMG/M
Scaffold ID	Ga0098042_1059629 Open in IMG/M
Source Dataset Name	Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1019
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	-14.198	Long. (^o)	-77.499	Alt. (m)		Depth (m)	38
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008343	Metagenome / Metatranscriptome	335	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098042_10596291	F008343	AGGAG	MKTQKKQKQLKLTVDQSKLLFNYNKANENKKAFTKLASDLKDPAVTIVDANGGQVFTTYKGHNVHAQTKHKEYFTIDLKKLQEDHPSIYNKYKTKEVHSITLEVNTVKI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.