NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098055_1002443

Scaffold Ga0098055_1002443


Overview

Basic Information
Taxon OID3300006793 Open in IMG/M
Scaffold IDGa0098055_1002443 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9634
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017831Metagenome / Metatranscriptome238Y
F025289Metagenome / Metatranscriptome202Y
F041784Metagenome / Metatranscriptome159Y
F044516Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0098055_100244318F041784GAGGMETKTIGEVGVDSGQLFITDPCYIKHQEQGNGQWNMEWMDGDDGKRVYKTLPDPTLDGETKNFYSKVCERNGSNQNGAEVELGVAFGTTHGDGNYAVKGIFDDDGVMVGIFIDMDGRVKAEFQYEDEEW*
Ga0098055_100244319F025289GAGMYVNERERGTQMNDCKNLSPTRWSMKQEIIEDLENYEEVNDDNIREICDGLVPVYNNELIEFCSHYQGEEFWELWLNNEIGGENPVEIIRGNLFSLYVNIGYEILSEREEDE*
Ga0098055_100244321F044516GAGMCRDTGYYEPRQDVAKKVVQEMVEKMNLDLMVYYLKMAYQEDQHTYMNDLYWVMQNKFDDVDQEAVARHVEELLRIDDTDKELFEQV*
Ga0098055_10024434F017831AGGAGMIAECMIFLASVLPMGVDETNLINEYMSCDDHVPKSMQKYAEHYVEHFDKENIPTAVRVGWCESRGKQSAYRDDNGDSGVMQFVSWTWNWVAEEYELPMWDYWVIMRYGKPFTENKTYKTDLGFEQVQVQFSPYYNILMASILAEDIYGRTQWRDWSSSEWCWGNEKEWRDKWLSEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.