NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066659_10443964

Scaffold Ga0066659_10443964


Overview

Basic Information
Taxon OID3300006797 Open in IMG/M
Scaffold IDGa0066659_10443964 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1030
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028279Metagenome192Y
F064013Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0066659_104439641F028279N/AMGKVRQLKKRADSVLEEVFRSLFEEIDAEKIRRDVAALKTEAPDFHPIDHAMILVRRTAIRCAAAGALTGLPSGLLAIGSLGADLAYLIYQQFRLIVGIAAIYGHEPSQ
Ga0066659_104439643F064013N/AAREVYRRIELDFASELSALGRYQDAIRFYRAVLKDDAQNREALDGLAAALDRLTVSRQKLLALEKGMSQREVARLLGKPIPGWTAKTDRPDCTIEAWYYRTTDRGVAGVYFRDGTLFAAEANSHEKLVPLTSR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.