NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102029_1046291

Scaffold Ga0102029_1046291


Overview

Basic Information
Taxon OID3300006849 Open in IMG/M
Scaffold IDGa0102029_1046291 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1261
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.539Long. (o)-110.798Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011398Metagenome / Metatranscriptome291N
F020181Metagenome / Metatranscriptome225N

Sequences

Protein IDFamilyRBSSequence
Ga0102029_10462911F020181GGAGGMKMLRFLFAVICAVALTTASVYAQEKDPNWAVYNPPNPKVVYTWLNLDRSFPYSNANAILDADILLRLPTLYRRDYKALPSGTRLPIHIAPDVQDLTKARWKVWRFGQFVADGIKVPTIEQLLESRTRQLRAVTYRPLPTLRSGDPIPHRVDGLRYGEMRIPVLNYSPDMITGYPCPPEGEPREAAGELPRVWLEVGDPRATGAALV
Ga0102029_10462912F011398N/AALIERAVLERPVTIWRMTPSYDAFLYQSKHKRENLFRLSTDGDGTWVVFEPERLRPLYGQYTSLSAADLPGEQTWSFRFTYDTSIPDFLSSQACRNNPDVRRGYPESLAKLLGDDFPGTVRIAKTYALLGNEYLTFAIVSSQPLDEVARLVTDRLGKTLNASLSPASVQIYGQRATRISLSRFLYQLNVEAIALDSQLTLVRGREVRFGGQSR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.