Basic Information | |
---|---|
Taxon OID | 3300006849 Open in IMG/M |
Scaffold ID | Ga0102029_1071228 Open in IMG/M |
Source Dataset Name | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1013 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.539 | Long. (o) | -110.798 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068875 | Metagenome / Metatranscriptome | 124 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102029_10712282 | F068875 | N/A | TQLELSPTNSNFPDIYRLITPKLDDVSSERPEAITEEIGATTYYVRDAARTITATVGQLPTEWAQRVAELRCQAEVGVFLVDANGTIWGRKVDTPTGVAGAPLPIVPSSIDARFAFPSYSSVQKHIITFQLPFTLADYEIIPLWNNQAVLNYSAPQPVGFRVFQEAGNWVVFLFSKYHAPNGTIVVPIANVANPADIEIYNASGSTLVASGSTNLGGGKYALNNPLTPGTQYILDCTAITSPPRTDFDWPALRVPFRA* |
⦗Top⦘ |