NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075425_100752508

Scaffold Ga0075425_100752508


Overview

Basic Information
Taxon OID3300006854 Open in IMG/M
Scaffold IDGa0075425_100752508 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1118
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001481Metagenome / Metatranscriptome687Y
F003919Metagenome / Metatranscriptome462Y
F042506Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0075425_1007525081F042506N/AVNSDRCCDQCNTERVIPALRLQARDAKRKGSNGGGLQMIDLNDIENDSFLAIHANDLRWLYALWVQLANESRPLDRQAIAKRLAAVLKNAEFC*
Ga0075425_1007525082F003919AGGAMNFVAPNSCLHDYKERRRAFLKHLIASTPNVSLRAKEFRRWIDQNSVSGDDDKA*
Ga0075425_1007525083F001481N/AMTKPKTWVDFARSLDADWPASPPTTITALVGEARAADWDFANWCYASGYDASDPDARRMFDCLLAYARREGGAGLN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.