Scaffold Ga0098066_1038690

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098066_1038690

Scaffold Ga0098066_1038690

Overview

Basic Information
Taxon OID	3300006856 Open in IMG/M
Scaffold ID	Ga0098066_1038690 Open in IMG/M
Source Dataset Name	Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	690
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Caribbean Sea: Cariaco Basin
Coordinates	Lat. (^o)	10.847	Long. (^o)	-65.114	Alt. (m)		Depth (m)	247
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061293	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098066_10386901	F061293	N/A	PEDTRSSAKYPFQHMDVGDSIFLPLKEGDNAKRMKNRLSQATRTYGKKQDPEQHFIIRYRLENEISGVRIWRKD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.