Scaffold Ga0066797_1000228

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066797_1000228

Scaffold Ga0066797_1000228

Overview

Basic Information
Taxon OID	3300006864 Open in IMG/M
Scaffold ID	Ga0066797_1000228 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17196
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (64.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	68.6135	Long. (^o)	-149.3144	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076588	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066797_100022813	F076588	AGGCGG	VSSGIVLLVLIGVGIAWLWTGGRKRLKLPVTGKHWGAIIIIVVVLLALLYGAKNVPHAPVH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.