NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075434_100236030

Scaffold Ga0075434_100236030


Overview

Basic Information
Taxon OID3300006871 Open in IMG/M
Scaffold IDGa0075434_100236030 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1848
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis algeriensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F004352Metagenome / Metatranscriptome442Y
F008441Metagenome / Metatranscriptome333Y
F070361Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0075434_1002360302F004352GGAGGMISRPEQDGDQQLRLLGDAWDKAAEHWRDGPARQFGTAQLTPCFQESRSYLEALRKLMDLLETAERETDG*
Ga0075434_1002360303F070361GGAVQQDSERLKQIRLWQQRIDAEAGEFSGIAGRFADLPENDLPRMEEHLVAIIASLEAARRVRAPAS*
Ga0075434_1002360304F001698AGGAGMAGVVNDIEALAEFRAHLMRFNHDLAENFATIQGHWRELGEIWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLSGYLETGAGAGLGSAVLPRCEG*
Ga0075434_1002360305F008441N/ARGEWEDVRALAGFLAGAGEESAATELRIRLGGAVWEEHREHLRTISNNMPPAAIERAINALRAILREVPEEFPDRNREVNCFLPPLASAVYAIMRKQGAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFDGICRRPGGPTT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.