Scaffold Ga0101947_1100113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101947_1100113

Scaffold Ga0101947_1100113

Overview

Basic Information
Taxon OID	3300006872 Open in IMG/M
Scaffold ID	Ga0101947_1100113 Open in IMG/M
Source Dataset Name	Biofilm microbial communities from drinking water pipes in Singapore
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Singapore Centre on Environmental Life Sciences Engineering
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	657
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes → Biofilm Microbial Communities From Drinking Water Pipes In Singapore

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057528	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101947_11001131	F057528	N/A	GTVYGKVSAQVEFLQSGADGIPLAQAFRFLAMDDDDARRFAAAAKQMEKQGFADTPTKNEAGQAAETLTQLLKSVRRLAATISSRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.