Basic Information | |
---|---|
Taxon OID | 3300006872 Open in IMG/M |
Scaffold ID | Ga0101947_1109723 Open in IMG/M |
Source Dataset Name | Biofilm microbial communities from drinking water pipes in Singapore |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 608 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes → Biofilm Microbial Communities From Drinking Water Pipes In Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.3 | Long. (o) | 103.8 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043437 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101947_11097232 | F043437 | GAG | MRANRFVLAIIAFVVLGMLTWSTITDEKLRLATMAVLALFAVKTILHRRDTRPGDDQAK* |
⦗Top⦘ |