Scaffold Ga0098060_1052634

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098060_1052634

Scaffold Ga0098060_1052634

Overview

Basic Information
Taxon OID	3300006921 Open in IMG/M
Scaffold ID	Ga0098060_1052634 Open in IMG/M
Source Dataset Name	Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1202
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	-16.21	Long. (^o)	-76.63	Alt. (m)		Depth (m)	30
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001156	Metagenome / Metatranscriptome	763	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098060_10526344	F001156	AGAAG	MAQRKPKDRSREILERIVGTKSKATLAEAFKVAFAEKYDVKRDEIKQGIVDKVYN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.