Scaffold Ga0099823_1023179

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099823_1023179

Scaffold Ga0099823_1023179

Overview

Basic Information
Taxon OID	3300006944 Open in IMG/M
Scaffold ID	Ga0099823_1023179 Open in IMG/M
Source Dataset Name	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5698
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	California, USA
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075758	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099823_10231796	F075758	AGG	MFLVPQVSVNFRISPPSKLYKFSRLSLEMCGFSPSYKILLSLFDILNAFYDNI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.