NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079104_1068394

Scaffold Ga0079104_1068394


Overview

Basic Information
Taxon OID3300006946 Open in IMG/M
Scaffold IDGa0079104_1068394 Open in IMG/M
Source Dataset NameRoot nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)750
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057456Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0079104_10683941F057456N/ANIPSVAFPIIQDLSLLHLVILCPAYATVRFVDNQTVRQD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.