NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079219_10468011

Scaffold Ga0079219_10468011


Overview

Basic Information
Taxon OID3300006954 Open in IMG/M
Scaffold IDGa0079219_10468011 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA Control
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)868
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012567Metagenome / Metatranscriptome279Y
F031219Metagenome / Metatranscriptome183N

Sequences

Protein IDFamilyRBSSequence
Ga0079219_104680111F012567GGGGGMRASDSSNTHEHRRSMAAVRHRKSSRGRSPSAWSDMTIAKSHALRFESKLLLLNAANHSYRRTRTRKDLKRVEHFRSELHRAEAAMRRTGLDELASENGDFWLQTYADLIDCATASLVRMRSTMSSREAADRFETATDVQMLEELIAQWTSRMRLIRQSTANGGHHKA*
Ga0079219_104680112F031219N/ASSAHSGDVADARRWFETYDELCRLKQKILTDLESQKVRVPPEGDAEVKDDEAMLRAEYERLLGRREFWHAEFEARQDR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.