NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079219_11778039

Scaffold Ga0079219_11778039


Overview

Basic Information
Taxon OID3300006954 Open in IMG/M
Scaffold IDGa0079219_11778039 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Georgia to study Nitrogen management - GA Control
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)575
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.8834Long. (o)-83.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006214Metagenome / Metatranscriptome378Y

Sequences

Protein IDFamilyRBSSequence
Ga0079219_117780391F006214N/AMALALVVALLQAAQAPVGSVPSWTLHFNGDIRWQQITPAGALLVSSDAALAGVDVERGQIVWQKPDLGGLPVDSVRMVEGSLLMEAAKPGLSVIFDPVTGTVLFDSRALGLTRVVTRRVLPQTGTLIVHGRRASGPPVVALYDLKTGNQRWVSESLFQQTGPKKGGLGGLMQGLVRVASEGTQLE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.