NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073932_1005331

Scaffold Ga0073932_1005331


Overview

Basic Information
Taxon OID3300007072 Open in IMG/M
Scaffold IDGa0073932_1005331 Open in IMG/M
Source Dataset NameHot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14093
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (56.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)49.9543Long. (o)-116.5155Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038570Metagenome / Metatranscriptome165N
F042758Metagenome / Metatranscriptome157N

Sequences

Protein IDFamilyRBSSequence
Ga0073932_10053315F042758GGAGGMKPTDFINLAARLPAQAITSATNTPSVDLQLLRGVAAICVVGAASTPPSFTIQSSPDNSTFTNITGKAIASIAANSEGVINVRDEELPDGHRWIRAVVNGTCTVAVAFIGTVARSDPPAPLASTTVVD*
Ga0073932_10053318F038570GGAGGMPATHMRRVQLGQQSAFTTPVTATSLLRGVTDGSVQIQHSDSVVQELGRNVSTLPVISQRYGEGEIELATTYEDILYALFGLFGPVAPSGNPPARVFNGPVSSFAAPQIYTVEYGTSGAEYRMVGAIIRDWTLRYEANANVTETWGLIGRNVQANGMASPTLRTVHPVLSRHATFYVDALGTPHGTTAIAGTAISFEMTIETNRHLKMFEDSNPLGWGEGRWNATMTIVAEFNAIAKAWVDALINSNVARNIRAEFIETANTREIQIDFVGMLTNAVELFSDRDGNMTVELEFSAIVGAPLSNWFSARVVNGVATLP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.