NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075435_100896787

Scaffold Ga0075435_100896787


Overview

Basic Information
Taxon OID3300007076 Open in IMG/M
Scaffold IDGa0075435_100896787 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)773
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071489Metagenome / Metatranscriptome122N
F075914Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0075435_1008967871F075914N/AMDRRTFVLLTGATSGALIRPTVLSNTPTGAERRWGGRLRFELDDHRRWSLWYYGDGSPVPVVRGAEIVAWVGDQPLTLAGLEDSTVGNRRPPGGDAVVVRGRAAGVWVEAELLTTGGASAPQASVTVTVFPDRYLPTVRGVRFFQLPQAEVLA
Ga0075435_1008967872F071489N/AMLTALVGLSTPLVGQNALTLGLAYTVGSGWQVEGFDVGVARAVHAGPIAALSLTARLGSFINEGAIIGGARGFVFGTSLAARTPTSTIAQLGADTSGGQIG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.