NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102532_1159632

Scaffold Ga0102532_1159632


Overview

Basic Information
Taxon OID3300007094 Open in IMG/M
Scaffold IDGa0102532_1159632 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1181
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3991438Long. (o)103.77518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047555Metagenome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0102532_11596321F047555N/AGAEHVRDADGCVRLGGLQMTVQAQVQAGVSARRLVQSGLATAVEDHTVQFVVDVGDCTEVWSDERTFAAAGYDEVDFSTIGIDVVKLLYVRNLSASHQIALSAGWTGSQFSVFRQDVSSWNFSPMINLGSLTLRGYPIRQGGTLLLSCPNSSGFGTTAGGSILRIGGTAGQAYEIYVMGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.