NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102700_1000667

Scaffold Ga0102700_1000667


Overview

Basic Information
Taxon OID3300007125 Open in IMG/M
Scaffold IDGa0102700_1000667 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 675950834
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29921
Total Scaffold Genes52 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (78.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103430Metagenome101N
F105376Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0102700_100066733F103430GAGGMKLITIKAFIGSNNKTKKLEVDKIISTVNANHEAFTLDYPVIGYWRGEVEETAVLYLSDERQKVMNTLNKLKEVLDQEAIAYQIENKLNLI*
Ga0102700_10006679F105376N/AMNEKPEVSAKEFGALWANVEHIKESVDRHTTTLERIENIARANVTQAQLKTYIAEHEKESEEKYVKRTEIEGVMNFWSLVTSNLAKLFAIALVGLAIYATNNLIQQNKTVTELKEEVQTQVRSK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.