Scaffold Ga0102976_1188562

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102976_1188562

Scaffold Ga0102976_1188562

Overview

Basic Information
Taxon OID	3300007169 Open in IMG/M
Scaffold ID	Ga0102976_1188562 Open in IMG/M
Source Dataset Name	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Singapore Centre on Environmental Life Sciences Engineering
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1297
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.286816	Long. (^o)	103.867024	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024040	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102976_11885625	F024040	AGGA	MNIYVTGHNWLAKVDIDSRKIDKSDWDNEACTRAVESVLDQEQKEGVDLKIQDYDDFGLGVILLTWDEKNSKNEDEHRVLLTSSVLANAGRWEEYKFVKDYEEKFKKEGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.