 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007177 Open in IMG/M |
| Scaffold ID | Ga0102978_1130759 Open in IMG/M |
| Source Dataset Name | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5474 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.286816 | Long. (o) | 103.867024 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001732 | Metagenome / Metatranscriptome | 644 | Y |
| F011485 | Metagenome / Metatranscriptome | 290 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102978_11307591 | F011485 | N/A | MIKSFKLFIVSILASVAVFAADTESSVRASINAGYNNHYIVNGLAKTSGQGFAGFDIGSTYFGVDGYVGGVILPDSNSIDESHWNVGVGKALKITEKFSLRGDLQLLRHQSSIVGGRNSIELAPKIALINPYLTPYIRGSHDFNLKQSGYIVGVERPTDVFGWVTVTPAIEYGKFTDYDVVAAKIGVSRTFFNHLQPYAEVGWYDNNFSASKYKFASQEFSGDIVAVAGVRWNF* |
| Ga0102978_11307595 | F001732 | N/A | MTTRFTLLLMLAFLFTGCFSTIRPPRPVDDNQKVIAKEEKKVDNTLVEMEKNGKGKRIQTSGLSVGIQHALNQVTNAPIQVDTARKLNERVISIVGSPHIDEIKRIKATVDLLNSALVEERKKGNKLQKEKSELNQKYDDQLWQLTDKAKEVAKEADQNKAVLDSMSGMFGLNAVFWGLKKFIFSALTAITIFVVIFVILRLLATVHPAAGAAFSIFNMLGSAIISILKALTPKAFEMCNYATKDKVDEFKSPLVKIVDVIQELKEKQKESPDRVYPLTEILKRFDKEMDSDEKDLIDDILREQKWIK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |