NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102978_1293232

Scaffold Ga0102978_1293232


Overview

Basic Information
Taxon OID3300007177 Open in IMG/M
Scaffold IDGa0102978_1293232 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1129
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.286816Long. (o)103.867024Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022860Metagenome / Metatranscriptome212Y
F029720Metagenome / Metatranscriptome187N
F052558Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0102978_12932321F052558GAGGMSKVDIAKLPIVKVKLCSHLKNAEPGELGPDLLRKIEGKGQLHHCAADAYEAMDAAANADGIDLSPTSPADTYRSLAVQEYGFFQRYTDDPKPALMK
Ga0102978_12932322F029720N/AMEKLKNILFRIFALFGSSALAAVAGGAIIGVELWKSAALAGLMACAQVVEKLLRFSVDGTLTKEEIEAAFSGAGAPKKKDEAAS*
Ga0102978_12932323F022860AGTAGMRKFFNFLSENSWTYAGTGMVLITLSGPTLRSALWITGVTLILHSALTLSQKD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.