NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099833_1004378

Scaffold Ga0099833_1004378


Overview

Basic Information
Taxon OID3300007178 Open in IMG/M
Scaffold IDGa0099833_1004378 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - OCT_C_1 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)570
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005746Metatranscriptome391N

Sequences

Protein IDFamilyRBSSequence
Ga0099833_10043781F005746N/AKERISALVQWLLKLRAGENPNRPPWWSDRYLHYAERVATRAPFEKFLQIVQAWRTALTAYGGLKTVPSRKDVEKFERAVGTARILTVPLPSGRIVEVDTEDWRARFPFRAFFGVSPRDVLPEVRIQRQIPPNNPLSLKLTDGRGNYTSVGEELFRDAWWVMQDHILHPPGTVPAYWPMLPVLPDFRPAP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.