Basic Information | |
---|---|
Taxon OID | 3300007178 Open in IMG/M |
Scaffold ID | Ga0099833_1018034 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - OCT_C_1 metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 558 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.534 | Long. (o) | -110.7978 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005746 | Metatranscriptome | 391 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099833_10180341 | F005746 | N/A | ERVSSLVQWLLKLRAGERPDRPPWWSDRYLNYAYRVATTAPFEKFLQLVQSWRVALTAYGQLKTTPSRADVEKFERAVGTARVLTVPLPSGRVVEVDTEDWRARFPFRAYFGVSPSDVLPEVRIQRKIHPNNPLSLKLTDGRGNYTAVGAELFKDAWWVMQDHIIHPPGTVPSYWPQLPVLPDFR |
⦗Top⦘ |