Basic Information | |
---|---|
Taxon OID | 3300007195 Open in IMG/M |
Scaffold ID | Ga0099831_1009274 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - OCT_B_1 metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 559 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | 44.534 | Long. (o) | -110.7978 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005746 | Metatranscriptome | 391 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099831_10092741 | F005746 | N/A | SGFDWTKERVSALVQWLLKLRAGENPSRPPWWSDRYLRYAEKVATKAPFEKFLQLVQAWRTALTAYGGLKTVPSKKDVEKFERAVGTARILTVPLPSGRVVEVDTEDWRSRFPFRAYFGVSPRDVLPEVRIQRQILPNNPLSLKLTDGKGNYTPVGEELFRDAWWVMQDHILHPPGTVPAYWPMLP |
⦗Top⦘ |