Scaffold Ga0075178_1063344

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075178_1063344

Scaffold Ga0075178_1063344

Overview

Basic Information
Taxon OID	3300007233 Open in IMG/M
Scaffold ID	Ga0075178_1063344 Open in IMG/M
Source Dataset Name	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B RNA (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	636
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location
Location Name	Milwaukee, Wisconsin, USA
Coordinates	Lat. (^o)	43.023	Long. (^o)	-87.895	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061006	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075178_10633441	F061006	N/A	NPRDIESPETEPFKRIDQMLPEKPGQSPKERANDIDNVLQWMRNRGVDQPEFKDEPFQTAKQMPLPDRRSPEQKAKDLDDVLQWVRNPRDSDSPSTEAFKRIDQLLPEKPGQSPEDRAKDLDNALTWVRNRGVDRPEFEATPTFDKLNSLPFDRRTPEQKARDVDDILNWKRNPRDIESPETEPFKRIDQMLPEKPGQSPKERANDIDNVL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.