 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007235 Open in IMG/M |
| Scaffold ID | Ga0075184_11087725 Open in IMG/M |
| Source Dataset Name | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 D RNA (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1037 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Milwaukee, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.023 | Long. (o) | -87.895 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030134 | Metagenome / Metatranscriptome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075184_110877251 | F030134 | N/A | IKDKIQPVLQRFKLRSCNFLIVEQTNYLSLYILKEKIIQHRGSNHVYR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |