NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099791_10001615

Scaffold Ga0099791_10001615


Overview

Basic Information
Taxon OID3300007255 Open in IMG/M
Scaffold IDGa0099791_10001615 Open in IMG/M
Source Dataset NameVadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8953
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameEel River Critical Zone Observatory, California, USA
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005261Metagenome / Metatranscriptome406Y
F077117Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0099791_100016155F005261GGAMIVGVRSALFQEDHMVRKVEMLAAKAGAVEGESAIEREGLKLAQDMPLKEQVIFTGSTDWSPDQAEHYIDWRIQCIDSDIARLRQQLDDLISSRKRWLAVTGGRSKVFANGNGHAAASSA
Ga0099791_100016156F077117N/ALIVTRARERGLDGVTLEWVLWGDGKAPQKGLNDAQGLPAKRAVDLQAVSREPHGQFASRIAAALQADLSHNELGQWSSAEVQHTVIWALKDLARRLRVLRFDMGETFELTDGWAGEIGLPVRPREAPPT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.