Basic Information | |
---|---|
Taxon OID | 3300007281 Open in IMG/M |
Scaffold ID | Ga0104349_1046939 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Xcelris labs Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2277 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nagpur, India | |||||||
Coordinates | Lat. (o) | 21.1458004 | Long. (o) | 79.0881546 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016311 | Metagenome / Metatranscriptome | 248 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104349_10469393 | F016311 | AGGAG | MIIGALLVAVGVLGYMYWDSEHNTVLKAPGVEIKKN* |
⦗Top⦘ |