NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079920_1034320

Scaffold Ga0079920_1034320


Overview

Basic Information
Taxon OID3300007301 Open in IMG/M
Scaffold IDGa0079920_1034320 Open in IMG/M
Source Dataset NameHydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBigelow Laboratory Single Cell Genomics Center (SCGC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)737
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise

Source Dataset Sampling Location
Location NameTeddy Bear Hydrothermal Vent, East Pacific Rise
CoordinatesLat. (o)9.847222Long. (o)-104.2975Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101351Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0079920_10343202F101351N/AMDKPAFSETVPNELKELGYVPPIIKSYDKNGINVWLDKRKKWYDVPFWQFTMDGVQWMVLDERHGSASQFYSHYKLARGHVICTGLGFGTREQWLASKPEVTKITVLEKFKEVIDYHKDIGTKWPDKIEIINCDANDYKGSCDFLSIDHYEYDDVLRILDSIKKVCNNITCECAWFWMLEPWIRLGYI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.