NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105011_1006493

Scaffold Ga0105011_1006493


Overview

Basic Information
Taxon OID3300007508 Open in IMG/M
Scaffold IDGa0105011_1006493 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8861
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)237
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032623Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0105011_100649314F032623N/AMMDDNAWIWFIIYLMPVTAVMWLLGMWANHEDYKKEHNIKGWSDRDMNVKQFIGATIVSVIVGSAAWVGGVYYGSIGMLDSIYGNVEQELDLLETKLENVSTKRIENQLEQLKVKVLNKVPSRQDIIDVSVQVDEINERILMLSTETQSLVTDLKFSVKEDLNKTTTDLTNKVDNTITAQSDSVKKEIGKLYDRVDVLYKELNEVTVLIDKAKTTFFGKSVFKEKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.