NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105012_1015543

Scaffold Ga0105012_1015543


Overview

Basic Information
Taxon OID3300007509 Open in IMG/M
Scaffold IDGa0105012_1015543 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5131
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)237
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031264Metagenome183N
F096030Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0105012_10155434F031264AGGAGMLDPKDVHIILIGCQRTQDYRHNLEIIRYNWLDYGKRVWITTVFNGDQNECASGCGENTFIYLPENTGYGYGALDSFNSGLEFARSGYRPYIAIFNFDVWFLTEEGFVTALNEFVESGKGFAAGYHQTHHWAMTDCMFFRREFLQKLLPIQDRVLASRKANKWLENEMSGTELGFENMEEWMMYSINKAVSDGQVREIRENKTNDDLMNNLDPNISAEWFQLERDGHPRYRYTDKYKLIHEHDDGLKKQLLAHHNIKKGHNICKYLGINIKHNVLNDVRQADGTTMAI*
Ga0105012_10155435F096030N/AMLRPNLASLSLSVSDTSTKKPIVIHHHNNLTMGGTEKMCQIFLKHFMKDSTFDHYVAYRKDGDNTREAYFKEIVGPEKMICYESPLELSNTIQIKKPFILHRYSAGIPEFPFVREVKENTRHFVSTAVFGNQDNTIDISKVIYVSKHVQWMANMQGVKNHHVVRNPIEAPYSTENLREELGIPDDAFVFGRIGRDDESIY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.