NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105000_1006067

Scaffold Ga0105000_1006067


Overview

Basic Information
Taxon OID3300007511 Open in IMG/M
Scaffold IDGa0105000_1006067 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23217
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (22.64%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)267
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049935Metagenome / Metatranscriptome146N
F106166Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0105000_10060673F106166AGGMILTNSSQFIGQLVSDLKPIEETISNPYFSYTLGFNIKHNEIRQCKLYIRFFDRDDSFLKFFEIFTDANIKAMAIHDFRHAEDIAFKKSALGFKGFTIGLVRDFNTNRTGCGWGARATSIISGPYFYGYRFFDDFLFRKMYKYVTPNLRFLKLPFMTEMVEIQESFEEKEHKYCLCPTITRDNLSEISRSIEGNLSPSCKLYHNEIIKLNPALTLVNMGIGPNEEKLYYHNFKKSNKIKHYFLNDE*
Ga0105000_100606742F049935N/AMVNMDTDIDFEFWDAQIKHFVSIFKSDISSEEDKEMAETHLNEIKARLKRDIKDLNKYIKELESEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.