NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105053_11205689

Scaffold Ga0105053_11205689


Overview

Basic Information
Taxon OID3300007522 Open in IMG/M
Scaffold IDGa0105053_11205689 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Bonney
CoordinatesLat. (o)-77.714Long. (o)162.445Alt. (m)Depth (m)83
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073115Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0105053_112056891F073115N/AAIPHAKAVRNWSSASLFKCASKSTASHYLFVLLRCSLAVGLKRLDQAAPGVQRVVHGVEQRQIAQQGTTVKVALRKYGAAHHFGF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.