NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099847_1019666

Scaffold Ga0099847_1019666


Overview

Basic Information
Taxon OID3300007540 Open in IMG/M
Scaffold IDGa0099847_1019666 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2205
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)37.1Long. (o)-76.0972Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F000645Metagenome / Metatranscriptome962Y

Sequences

Protein IDFamilyRBSSequence
Ga0099847_10196662F000545N/AMKQDAHPFMCSNCKLVCAHIEVQRYNTEDVADAPSEVWLIECQRCFMQRIIYPSDRVASKEDDIVRCNQCGGWKMKAAKCRICRLAAGFETLQVNYFTGHQDLKRPYADL*
Ga0099847_10196663F000645GGAGMSNWLEDYEGVWDRFEKFKNDYPDYRHKSHILAESLIAQSEVFIIKTELYRTWNDAEPFATGLSSEVKSKQYSIELCETGSLGRALMMAGYPAKPKGFAKKPIETTSPKLAEFVKEQRPNDPEPIVWDVSQVAEQLGATVVDEMPLCQGGCGPMVLKTGTKEGKEYRGWVCPKRDSGHPAKWMKIGSDGHWVFK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.