Scaffold Ga0099846_1219622

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099846_1219622

Scaffold Ga0099846_1219622

Overview

Basic Information
Taxon OID	3300007542 Open in IMG/M
Scaffold ID	Ga0099846_1219622 Open in IMG/M
Source Dataset Name	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	666
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location Name	USA: Chesapeake Bay
Coordinates	Lat. (^o)	38.8455	Long. (^o)	-76.4191	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085402	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099846_12196221	F085402	N/A	RDNQMAAETQTETGQTYEVGQQTQVRKTIQRTRKMKLKGYFKPTPKRFRVLGDSIAAASLFIAGLNLDNPKLMMISGVCGAVGKFVTNFFAEDETK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.