Basic Information | |
---|---|
Taxon OID | 3300007555 Open in IMG/M |
Scaffold ID | Ga0102817_1000247 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 15662 |
Total Scaffold Genes | 33 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 26 (78.79%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River Estuary, USA | |||||||
Coordinates | Lat. (o) | 46.2 | Long. (o) | -123.94 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048361 | Metagenome / Metatranscriptome | 148 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102817_100024733 | F048361 | N/A | EEDCFVMGKNISATLLFALVLQAAMIVWSISQMRADVDANYASIVRISGDVKAVEASSNMQAVQLGKIEENIKGIKESLERMLEVMEKD* |
⦗Top⦘ |