NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102913_1044822

Scaffold Ga0102913_1044822


Overview

Basic Information
Taxon OID3300007560 Open in IMG/M
Scaffold IDGa0102913_1044822 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1560A-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1446
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2638Long. (o)-123.4649Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005742Metagenome / Metatranscriptome391Y
F007116Metagenome / Metatranscriptome357Y
F023791Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0102913_10448222F007116N/AMARSTPNINIDTTQKLRDRLGFKQFVLQVNTDTFIYNYIPSTIELNEDGRLFTLTLINKKFIFDILELDDVSDYVDVYLFGVKQPQDKYNVVINGNNIVITFISDVTRLPGEVGVDDFEIKGKIAEIL*
Ga0102913_10448223F005742N/AMNIRQLKNIMKEINEPNEFELFAHDLLHPYYWIYKIENVRVKTLFSKLESLRNPSARFDVFINGLFISENDYIVENKGNAFYIKFIKVNFPEFDRFGNPYTLDENDEVKINGDLETFRN*
Ga0102913_10448224F023791N/AVEAFQYATDRYWGSEEKYKFRVRINSFDNQQEVGQGSERIIRTTFTMQVNAYLLPETFNENPVVKKERSKKRVVFGIETDLTGNLFNQPSLYNEYAQIIDFVAIRSSQMATFVNATTVKLTNVKKPLLPSELVGVFDTDNWFRVYVNGDFVSPTYYTYSYNGATNEIVFVFSLTYPLDANDEIAITGKFQEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.