Basic Information | |
---|---|
Taxon OID | 3300007623 Open in IMG/M |
Scaffold ID | Ga0102948_1160632 Open in IMG/M |
Source Dataset Name | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 684 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South San Francisco, USA | |||||||
Coordinates | Lat. (o) | 37.4962 | Long. (o) | -122.1329 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009725 | Metagenome / Metatranscriptome | 314 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102948_11606323 | F009725 | N/A | NLSIIQILLTHTHIRRYKMLIWEKMKNTCASIGYARAAAQLSAQGRHEFARQLMLDGLKEVAEKKRAIQRLERVRKAKASYEPGDHYMKGHKVAFWRGHADA* |
⦗Top⦘ |