Scaffold Ga0102894_1165615

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102894_1165615

Scaffold Ga0102894_1165615

Overview

Basic Information
Taxon OID	3300007632 Open in IMG/M
Scaffold ID	Ga0102894_1165615 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	587
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location Name	Columbia River Estuary, USA
Coordinates	Lat. (^o)	46.2871	Long. (^o)	-123.9424	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043943	Metagenome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102894_11656151	F043943	N/A	TGTDAATPTWTKISEHNRAAINLDLNRIEKTQRMSNGSLRKIWIADKKEISTSWGALPTYSTLTVDGGYGAADIRAFYLNKGTGTFKIKISYNAVALRDEIILASFTSCSFTISKRNIRSTTASVPQEFWDVSFSLEEV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.