NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102901_1122985

Scaffold Ga0102901_1122985


Overview

Basic Information
Taxon OID3300007634 Open in IMG/M
Scaffold IDGa0102901_1122985 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1555A-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)739
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2024Long. (o)-123.9409Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009333Metagenome / Metatranscriptome319Y
F053303Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0102901_11229851F053303N/AMSNLKVQIAGTIYQINEKAFRTTGWNREPITPYFYASYVAAGQLVKQWVKKNYPNVVCRVKGDSFANGNSMHVNVSNPDGSPIPQADYEAINNFANLFEYGRYNGQEDLYESYENSGLVTDNGTKIEAGVKYVSVDNRPSFGTVEWARYELSVGRPYKDLSRYCDTKILDK
Ga0102901_11229852F009333N/AEMMDYHSDTLRAVEDFYMNQNQSWFNEVYNMLCGIWDGYLYTDLLESAKQLGLPTHITNRIQYTINFIQK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.