NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102856_1000928

Scaffold Ga0102856_1000928


Overview

Basic Information
Taxon OID3300007636 Open in IMG/M
Scaffold IDGa0102856_1000928 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1371A-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3468
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2342Long. (o)-123.9167Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002398Metagenome / Metatranscriptome563Y
F019834Metagenome227N
F021296Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0102856_10009281F021296AGGAMSDTRTSFLELDDAPVKIQPNTSVFSNAGGFQVAEGSTAKQDANGNWVNAIGLQSTASHRHVSKVWQNKCTPLADFVNVVKGEAPNKKDITKKESEIRLLDANTLIDGTPLNESGLNSLRMFTDIPSTMLNFLKEREYNDEMVKFVNGELDRRETEWNGKGKDARSFLVRTRQDDEGNDIIRAIVSERYGVIDNAEAMEIIANSLPSLDDALASHIFNNGDDIFGNILLPDHMKSEPDSDYGVGIAFKNSEIRNSTFRISPF
Ga0102856_10009286F002398GGAMIALISIFLLTSVDPIKNFVSLKTYISENAKAHCYVYFINEDLPDFPRVNVIEKSKFDFFAYLDTIGIEHSKVGSYYFFQRKPK*
Ga0102856_10009288F019834N/ATGTIFVPDNAEYEYDFENQIYTFKINDKTYSLIAGLEADDKEMIVTDENFKSHDIKPFEYEDAYFED*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.