NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102902_1005582

Scaffold Ga0102902_1005582


Overview

Basic Information
Taxon OID3300007644 Open in IMG/M
Scaffold IDGa0102902_1005582 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1555B-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3703
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2024Long. (o)-123.9409Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F021288Metagenome / Metatranscriptome219Y
F037727Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0102902_10055821F000263GGAMNAEDIGLPPHLQRLVNAGVNGLDIMHGELKNLMLIAEEQLAWAQAIEDETEEAMDSMARTETEGRLDTLVELYKLTYDLSFAIGARNV*
Ga0102902_10055822F037727GAGMKIHRISLIQDNANLIQDTNAPDWNFLQGQIVATEHLLSVATDIMNDNLQGKGY*
Ga0102902_10055823F021288GGTGGMLGYTQRDLADMTYGVYQADLLINADENPAIHNYLVTAHDFLQGLWAEGYFDNAN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.