Basic Information | |
---|---|
Taxon OID | 3300007665 Open in IMG/M |
Scaffold ID | Ga0102908_1007230 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2062 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River Estuary, USA | |||||||
Coordinates | Lat. (o) | 46.2763 | Long. (o) | -124.0055 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008495 | Metagenome / Metatranscriptome | 332 | N |
F020694 | Metagenome / Metatranscriptome | 222 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102908_10072303 | F008495 | GGAG | LNILIVYHLRLGDIARCLPIAKHFADQGHNVMFECLPEYHGLFEMVDYCKPLYPQNDHSGFHRIINLQIWPDLHEDFCASELGWSDYVYGLFPEGKDIDRQIVLNSPAIVTPPELKSWVLCFPTGYSQDKKIDVRDVITIAHQVANGRPVLCAGKAAHGMAEFESIEYMCAYIRDALEVVTINTSTSILASALRKSWVHISDSPKHDFKHPNQRRIERKF* |
Ga0102908_10072304 | F020694 | N/A | MNELPLAVTFGERNFLANRTTYKRDNSLADGGFMDSASMTITAIYDSFVQTISLGDVLVIGGRRFRVTSAELSQDAVSVDFT |
⦗Top⦘ |