NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102859_1002035

Scaffold Ga0102859_1002035


Overview

Basic Information
Taxon OID3300007708 Open in IMG/M
Scaffold IDGa0102859_1002035 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1371B-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4637
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (23.08%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2342Long. (o)-123.9167Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054865Metagenome / Metatranscriptome139N
F057359Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0102859_10020356F054865N/AMEVKTKRFIIKYREGIVSVAANDVAEAIEKFKELRIETSAKELTILPADEMHKRREEIFRKE*
Ga0102859_10020358F057359N/AVFIDFLNPSDKRSKYPPRVAAIATVIALLELWFSIQGQTTGAEFWAMFFFIGAIICFGYVLEIQFIEKGIEAYGIGIKTPRKRNVTKKDKEPVKMNTTVRSVQLSLAIMLILGITTINAQNNHFMAYNTMSLEKIDKGLLERRYYSEADDSYTVDTITYDLLSGIDLWDGYSRTTYDNCLFMTYGTQNIEYFPLAGIWKYNNKYYDYIGLLKFVSKYVKRNFLNKKINYGKIRRH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.