Basic Information | |
---|---|
Taxon OID | 3300007735 Open in IMG/M |
Scaffold ID | Ga0104988_10273 Open in IMG/M |
Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12730 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (68.75%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gangwon-do, South Korea | |||||||
Coordinates | Lat. (o) | 37.953056 | Long. (o) | 127.81721 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002009 | Metagenome / Metatranscriptome | 604 | Y |
F065527 | Metagenome / Metatranscriptome | 127 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104988_1027312 | F002009 | N/A | MNPPTIGELGEAAADIVWRVMGKGSDKSSYGEWFHVDKPVHDYHIGRAMRHLSTAMLQLQKSTPCPDNNGETAADHLERAVVRALFVWAQVKKEVPRL* |
Ga0104988_102736 | F065527 | N/A | MKATIMLMALLVAGVYGEEDEIESSQQELADFCGGVLGKSAVITGRNTAVTSDGEFVSYNGRGFATSNGYYGKNGSQVFGNGKLVVRSKNLFYGSSSSCRNGNSYYDGDKSSWITKSSELDD* |
⦗Top⦘ |